- Recombinant Arabidopsis thaliana Reticulon-like protein B14 (RTNLB14)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1257221
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 25,259 Da
- E Coli or Yeast
- 1-215
- T22E19.14, T22E19_14
- Reticulon-like protein B14 (RTNLB14)
Sequence
MAVFGYEMDEHRASSSRRRRSLYHNLGGGRFADIMFWKNKKESGTILGVFTLIWFLFEVVEYPFITFLCQILLLFIFIFLIWSYIGSSQLIQSKPPSINDLRISESNWRFLFNKINWFIIKLYDISSGKDFRLLFLAVVSLWILSVVGNYFSSLTLLYIVFVGLETIPMLYEQYEEELTYAASKSGRDMKKLLNKFNSKVINKIPKAQAKTRRTM